Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Antibody Laboratories manufactures the antibody for human protein reagents distributed by Genprice. The Antibody For Human Protein reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Antibody products are available in stock. Specificity: Antibody Category: For Group: Human Protein
Human True insulin ELISA kit |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Human True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human True insulin ELISA kit |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Human True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human True insulin ELISA kit |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Human True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human True Insulin GENLISA ELISA |
Krishgen |
1 x 96 wells |
EUR 286 |
Human True insulin ELISA kit |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Human Protein information
Antibody for Human Protein kinase D2 (pSer197 + pSer198) |
SPC-1067D-RPE |
Stressmarq |
0.1ml |
EUR 476.4 |
Description: A polyclonal antibody for Protein kinase D2 (pSer197 + pSer198) from Human. The antibody is produced in rabbit after immunization with Human A phospho-specific peptide corresponding to residues surrounding Ser197 and Ser198 of human Protein Kinase D2 (AA194-201). The Antibody is tested and validated for WB, AM assays with the following recommended dilutions: WB (1:250). This Protein kinase D2 (pSer197 + pSer198) antibody is conjugated to RPE . |
Antibody for Human Protein kinase D2 (pSer197 + pSer198) |
SPC-1067D-STR |
Stressmarq |
0.1ml |
EUR 477.6 |
Description: A polyclonal antibody for Protein kinase D2 (pSer197 + pSer198) from Human. The antibody is produced in rabbit after immunization with Human A phospho-specific peptide corresponding to residues surrounding Ser197 and Ser198 of human Protein Kinase D2 (AA194-201). The Antibody is tested and validated for WB, AM assays with the following recommended dilutions: WB (1:250). This Protein kinase D2 (pSer197 + pSer198) antibody is conjugated to Streptavidin. |
ELISA kit for Human Myelin basic protein antibody (MBP-Ab) |
KTE62476-48T |
Abbkine |
48T |
EUR 424.8 |
|
Description: Quantitative sandwich ELISA for measuring Human Myelin basic protein antibody (MBP-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Myelin basic protein antibody (MBP-Ab) |
KTE62476-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Myelin basic protein antibody (MBP-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Myelin basic protein antibody (MBP-Ab) |
KTE62476-96T |
Abbkine |
96T |
EUR 686.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Myelin basic protein antibody (MBP-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Heat Shock Protein 70 antibody (HSP70-Ab) |
KTE62472-48T |
Abbkine |
48T |
EUR 398.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Heat Shock Protein 70 antibody (HSP70-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Heat Shock Protein 70 antibody (HSP70-Ab) |
KTE62472-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2538 |
|
Description: Quantitative sandwich ELISA for measuring Human Heat Shock Protein 70 antibody (HSP70-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Heat Shock Protein 70 antibody (HSP70-Ab) |
KTE62472-96T |
Abbkine |
96T |
EUR 646.8 |
|
Description: Quantitative sandwich ELISA for measuring Human Heat Shock Protein 70 antibody (HSP70-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Proteinase 3 Antibody (PR3Ab) |
KTE62482-48T |
Abbkine |
48T |
EUR 398.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Proteinase 3 Antibody (PR3Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Proteinase 3 Antibody (PR3Ab) |
KTE62482-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2538 |
|
Description: Quantitative sandwich ELISA for measuring Human Proteinase 3 Antibody (PR3Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Proteinase 3 Antibody (PR3Ab) |
KTE62482-96T |
Abbkine |
96T |
EUR 646.8 |
|
Description: Quantitative sandwich ELISA for measuring Human Proteinase 3 Antibody (PR3Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Anti-CRP (Anti-C Reactive Protein Antibody) |
ELK8060 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
Description: A competitive Inhibition ELISA kit for detection of Anti-C Reactive Protein Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Human Anti-MBP (Anti-Myelin Basic Protein Antibody) |
ELK8048 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
Description: A competitive Inhibition ELISA kit for detection of Anti-Myelin Basic Protein Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) |
KTE62490-48T |
Abbkine |
48T |
EUR 424.8 |
|
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) |
KTE62490-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) |
KTE62490-96T |
Abbkine |
96T |
EUR 686.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Anti-PLP1 (Anti-Proteolipid Protein 1, Myelin Antibody) |
ELK8082 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
Description: A competitive Inhibition ELISA kit for detection of Anti-Proteolipid Protein 1, Myelin Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Welcome to our blog!