Welcome to our blog!

Apoptosis

A form of programmed cell death that occurs in multicellular organisms

Menu

Antibody For Human Protein

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the antibody for human protein reagents distributed by Genprice. The Antibody For Human Protein reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Antibody products are available in stock. Specificity: Antibody Category: For Group: Human Protein

True Blue

5x5(mg
EUR 2705

Human True insulin ELISA kit

192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Human True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human True insulin ELISA kit

1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Human True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human True insulin ELISA kit

1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Human True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human True insulin ELISA kit

96T
EUR 700
Description: ELISA

Human True Insulin ELISA Kit

10x96-Strip-Wells
EUR 6725

Human True Insulin ELISA Kit

48-Strip-Wells
EUR 550

Human Protein information

ELISA kit for Human Proteinase 3 Antibody (PR3Ab)

KTE62482-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Human Proteinase 3 Antibody (PR3Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Proteinase 3 Antibody (PR3Ab)

KTE62482-96T 96T
EUR 646.8
Description: Quantitative sandwich ELISA for measuring Human Proteinase 3 Antibody (PR3Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Heat Shock Protein 70 antibody (HSP70-Ab)

KTE62472-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Human Heat Shock Protein 70 antibody (HSP70-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Anti-CRP (Anti-C Reactive Protein Antibody)

ELK8060 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Anti-C Reactive Protein Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Anti-MBP (Anti-Myelin Basic Protein Antibody)

ELK8048 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Anti-Myelin Basic Protein Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab)

KTE62490-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab)

KTE62490-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab)

KTE62490-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Anti-PLP1 (Anti-Proteolipid Protein 1, Myelin Antibody)

ELK8082 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Anti-Proteolipid Protein 1, Myelin Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Antibody for Human p38

SPC-172D-A565 0.1ml
EUR 373.2
Description: A polyclonal antibody for p38 from Human | Mouse | Rat | Bovine | Monkey | rabbit | Pig | Dog | Hamster | Chicken | Sheep | Guinea Pig (Cavia porcellus). The antibody is produced in rabbit after immunization with Human A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. The Antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100), IP (1:250). This p38 antibody is conjugated to ATTO 565.

Antibody for Human p38

SPC-172D-A633 0.1ml
EUR 373.2
Description: A polyclonal antibody for p38 from Human | Mouse | Rat | Bovine | Monkey | rabbit | Pig | Dog | Hamster | Chicken | Sheep | Guinea Pig (Cavia porcellus). The antibody is produced in rabbit after immunization with Human A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. The Antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100), IP (1:250). This p38 antibody is conjugated to ATTO 633.

Antibody for Human p38

SPC-172D-A655 0.1ml
EUR 373.2
Description: A polyclonal antibody for p38 from Human | Mouse | Rat | Bovine | Monkey | rabbit | Pig | Dog | Hamster | Chicken | Sheep | Guinea Pig (Cavia porcellus). The antibody is produced in rabbit after immunization with Human A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. The Antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100), IP (1:250). This p38 antibody is conjugated to ATTO 655.

Antibody for Human p38

SPC-172D-A680 0.1ml
EUR 373.2
Description: A polyclonal antibody for p38 from Human | Mouse | Rat | Bovine | Monkey | rabbit | Pig | Dog | Hamster | Chicken | Sheep | Guinea Pig (Cavia porcellus). The antibody is produced in rabbit after immunization with Human A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. The Antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100), IP (1:250). This p38 antibody is conjugated to ATTO 680.

Antibody for Human p38

SPC-172D-A700 0.1ml
EUR 373.2
Description: A polyclonal antibody for p38 from Human | Mouse | Rat | Bovine | Monkey | rabbit | Pig | Dog | Hamster | Chicken | Sheep | Guinea Pig (Cavia porcellus). The antibody is produced in rabbit after immunization with Human A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. The Antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100), IP (1:250). This p38 antibody is conjugated to ATTO 700.

Antibody for Human p38

SPC-172D-APCCY7 0.1ml
EUR 459.6
Description: A polyclonal antibody for p38 from Human | Mouse | Rat | Bovine | Monkey | rabbit | Pig | Dog | Hamster | Chicken | Sheep | Guinea Pig (Cavia porcellus). The antibody is produced in rabbit after immunization with Human A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. The Antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100), IP (1:250). This p38 antibody is conjugated to APC/Cy7.

Antibody for Human p38

SPC-172D-DY350 0.1ml
EUR 391.2
Description: A polyclonal antibody for p38 from Human | Mouse | Rat | Bovine | Monkey | rabbit | Pig | Dog | Hamster | Chicken | Sheep | Guinea Pig (Cavia porcellus). The antibody is produced in rabbit after immunization with Human A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. The Antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100), IP (1:250). This p38 antibody is conjugated to Dylight 350.

Antibody for Human p38

SPC-172D-DY405 0.1ml
EUR 376.8
Description: A polyclonal antibody for p38 from Human | Mouse | Rat | Bovine | Monkey | rabbit | Pig | Dog | Hamster | Chicken | Sheep | Guinea Pig (Cavia porcellus). The antibody is produced in rabbit after immunization with Human A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. The Antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100), IP (1:250). This p38 antibody is conjugated to Dylight 405.

A nice attention grabbing header!

A descriptive sentence for the Call To Action (CTA).

Contact Us