Welcome to our blog!

Apoptosis

A form of programmed cell death that occurs in multicellular organisms

Menu

Antibody For Human Protein

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the antibody for human protein reagents distributed by Genprice. The Antibody For Human Protein reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Antibody products are available in stock. Specificity: Antibody Category: For Group: Human Protein

True north Cryobox 5mLNatural

PK10
EUR 153.6

True north Cryobox 5mLBlue

PK10
EUR 153.6

True north Cryobox 15mLNatural

PK10
EUR 212.4

True north Cryobox 15mLBlue

PK10
EUR 212.4

True north Cryobox 50mLNatural

PK10
EUR 210

True north Cryobox 50mLBlue

PK10
EUR 210

True north Cryobox1.5/2mLNatural

PK10
EUR 162

Human Protein information

Antibody for Human Protein kinase D2 (pSer197 + pSer198)

SPC-1067D-RPE 0.1ml
EUR 476.4
Description: A polyclonal antibody for Protein kinase D2 (pSer197 + pSer198) from Human. The antibody is produced in rabbit after immunization with Human A phospho-specific peptide corresponding to residues surrounding Ser197 and Ser198 of human Protein Kinase D2 (AA194-201). The Antibody is tested and validated for WB, AM assays with the following recommended dilutions: WB (1:250). This Protein kinase D2 (pSer197 + pSer198) antibody is conjugated to RPE .

Antibody for Human Protein kinase D2 (pSer197 + pSer198)

SPC-1067D-STR 0.1ml
EUR 477.6
Description: A polyclonal antibody for Protein kinase D2 (pSer197 + pSer198) from Human. The antibody is produced in rabbit after immunization with Human A phospho-specific peptide corresponding to residues surrounding Ser197 and Ser198 of human Protein Kinase D2 (AA194-201). The Antibody is tested and validated for WB, AM assays with the following recommended dilutions: WB (1:250). This Protein kinase D2 (pSer197 + pSer198) antibody is conjugated to Streptavidin.

ELISA kit for Human Myelin basic protein antibody (MBP-Ab)

KTE62476-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Myelin basic protein antibody (MBP-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Myelin basic protein antibody (MBP-Ab)

KTE62476-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Myelin basic protein antibody (MBP-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Myelin basic protein antibody (MBP-Ab)

KTE62476-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Myelin basic protein antibody (MBP-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Proteinase 3 Antibody (PR3Ab)

KTE62482-48T 48T
EUR 398.4
Description: Quantitative sandwich ELISA for measuring Human Proteinase 3 Antibody (PR3Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Proteinase 3 Antibody (PR3Ab)

KTE62482-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Human Proteinase 3 Antibody (PR3Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Proteinase 3 Antibody (PR3Ab)

KTE62482-96T 96T
EUR 646.8
Description: Quantitative sandwich ELISA for measuring Human Proteinase 3 Antibody (PR3Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Heat Shock Protein 70 antibody (HSP70-Ab)

KTE62472-48T 48T
EUR 398.4
Description: Quantitative sandwich ELISA for measuring Human Heat Shock Protein 70 antibody (HSP70-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Heat Shock Protein 70 antibody (HSP70-Ab)

KTE62472-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Human Heat Shock Protein 70 antibody (HSP70-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Heat Shock Protein 70 antibody (HSP70-Ab)

KTE62472-96T 96T
EUR 646.8
Description: Quantitative sandwich ELISA for measuring Human Heat Shock Protein 70 antibody (HSP70-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Anti-CRP (Anti-C Reactive Protein Antibody)

ELK8060 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Anti-C Reactive Protein Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Anti-MBP (Anti-Myelin Basic Protein Antibody)

ELK8048 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Anti-Myelin Basic Protein Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab)

KTE62490-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab)

KTE62490-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Protein-arginine deiminase type-4 antibody (PADI4-Ab)

KTE62490-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Protein-arginine deiminase type-4 antibody (PADI4-Ab) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Anti-PLP1 (Anti-Proteolipid Protein 1, Myelin Antibody)

ELK8082 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Anti-Proteolipid Protein 1, Myelin Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

A nice attention grabbing header!

A descriptive sentence for the Call To Action (CTA).

Contact Us