Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Monoclonal Laboratories manufactures the monoclonal antibody humanagin study reagents distributed by Genprice. The Monoclonal Antibody Humanagin Study reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: Humanagin Study
Dog True insulin ELISA kit |
|
BlueGene |
192 tests |
EUR 1524 |
|
|
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog True insulin ELISA kit |
|
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
|
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Humanagin Study information
Human CD9 Monoclonal antibody |
|
9PU-01MG |
ImmunoStep |
0,1 mg |
EUR 149.6 |
Human CD4 Monoclonal antibody |
|
4A-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD4 Monoclonal antibody |
|
4AC750-100T |
ImmunoStep |
100 test |
EUR 457.6 |
Human CD4 Monoclonal antibody |
|
4CFB-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Human CD4 Monoclonal antibody |
|
4F-100T |
ImmunoStep |
100 test |
EUR 215.6 |
Human CD4 Monoclonal antibody |
|
4PE-100T |
ImmunoStep |
100 test |
EUR 266.2 |
Human CD4 Monoclonal antibody |
|
4PP-100T |
ImmunoStep |
100 test |
EUR 290.4 |
Human CD4 Monoclonal antibody |
|
4PPC5.5-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Human CD6 Monoclonal antibody |
|
6A-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD6 Monoclonal antibody |
|
6F-100T |
ImmunoStep |
100 test |
EUR 215.6 |
Human CD6 Monoclonal antibody |
|
6PE-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD5 Monoclonal antibody |
|
5A-100T |
ImmunoStep |
100 test |
EUR 276.1 |
Human CD5 Monoclonal antibody |
|
5A1-100T |
ImmunoStep |
100 test |
EUR 248.6 |
Human CD5 Monoclonal antibody |
|
5F-100T |
ImmunoStep |
100 test |
EUR 221.1 |
Human CD5 Monoclonal antibody |
|
5F1-100T |
ImmunoStep |
100 test |
EUR 204.6 |
Human CD5 Monoclonal antibody |
|
5PE1-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD5 Monoclonal antibody |
|
5PPC5.51-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Welcome to our blog!