Welcome to our blog!

Apoptosis

A form of programmed cell death that occurs in multicellular organisms

Menu

Chimeric And Humanized Monoclonal Antibodies

Anti-Myc and Anti-DDK monoclonal antibodies

TA150014 2 tubes @ 50 ul each Ask for price

Human Antibody Laboratories manufactures the chimeric and humanized monoclonal antibodies reagents distributed by Genprice. The Chimeric And Humanized Monoclonal Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Chimeric products are available in stock. Specificity: Chimeric Category: And Group: Humanized Monoclonal

True Blue

50mg Ask for price
Description: True Blue

True Blue

5mg Ask for price
Description: True Blue

Monoclonal PP2A alpha and beta Antibody

0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Humanized Monoclonal information

Chimeric Rabbit Anti-RSV pre- and postfusion conformation of HRSV F protein monoclonal antibody, clone STC26

CABT-L2690 200 µg
EUR 987
Description: Rabbit

Chimeric Rabbit Anti-RSV pre- and postfusion conformation of HRSV F protein monoclonal antibody, clone STC27

CABT-L2692 200 µg
EUR 987
Description: Rabbit

Chimeric Mouse Anti-C. perfringens epsilon toxin (ETX) monoclonal antibody, clone 1351

CABT-L2597 100 µg
EUR 1029
Description: Mouse

A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Tecentriq sequence

TA813014 100 µl Ask for price

A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Tecentriq sequence

TA813014S 30 µl Ask for price

A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Avelumab sequence

TA813015 100 µl Ask for price

A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Avelumab sequence

TA813015S 30 µl Ask for price

Anti-Myc and Anti-DDK monoclonal antibodies

TA150014 2 tubes @ 50 ul each Ask for price

Humanized Monoclonal Anti-Human VEGF protein (Avastin/bevacizumab biosimilar) protein IgG1 (neutralizing)

VEGF19-M 50 ug
EUR 578.4

TruStrip RDT 5-Minute rapid test to confirm the presence of humanized antibodies, 10 tests/pk

1750-RDT-10 1 kit
EUR 424.8

Carrier-free (BSA/glycerol-free) A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Tecentriq sequence

CF813014 100 µg Ask for price

Carrier-free (BSA/glycerol-free) A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Avelumab sequence

CF813015 100 µg Ask for price

Humanized Monoclonal Anti-Flavivirus Envelope Protein DII (EDII) IgG1 (Crossreactive with Dengue, Zika, West Nile, JEV, etc)

ZENV17-M 100 ul
EUR 578.4

Humanized Monoclonal Anti-Zika Virus Envelope Protein DIII (EDIII) IgM (non-reactive with related flavivruses; Neutralizing)

ZENV16-M 100 ul
EUR 578.4

HA Tag Chimeric Human Antibody

R20305-100UG 100ug
EUR 347.65
Description: This antibody reacts to recombinant proteins containing a HA-Tag fused to either the amino or carboxy terminus. An anti-human IgG secondary is required for this mAb. No cross reactivity with any endogenous protein.

His Tag Chimeric Human Antibody

R20303-100UG 100ug
EUR 347.65
Description: This antibody is a Human-Rabbit chimeric antibody made by fusion of the antigen binding region (variable domains of the heavy and light chains, VH and VL) of rabbit anti-His Tag monoclonal antibody (RM146), with the constant domain of Human IgG1. The mAb is recognized only by an anti-Human IgG secondary antibody.

Human Chimeric IgE

GWB-8D02C7 2 ml Ask for price

A nice attention grabbing header!

A descriptive sentence for the Call To Action (CTA).

Contact Us