Human Antibody Laboratories manufactures the chimeric and humanized monoclonal antibodies reagents distributed by Genprice. The Chimeric And Humanized Monoclonal Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Chimeric products are available in stock. Specificity: Chimeric Category: And Group: Humanized Monoclonal
Monoclonal PP2A alpha and beta Antibody |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Humanized Monoclonal information
Chimeric Rabbit Anti-RSV pre- and postfusion conformation of HRSV F protein monoclonal antibody, clone STC26 |
CABT-L2690 |
Creative Diagnostics |
200 µg |
EUR 987 |
|
Description: Rabbit |
Chimeric Rabbit Anti-RSV pre- and postfusion conformation of HRSV F protein monoclonal antibody, clone STC27 |
CABT-L2692 |
Creative Diagnostics |
200 µg |
EUR 987 |
|
Description: Rabbit |
Chimeric Mouse Anti-C. perfringens epsilon toxin (ETX) monoclonal antibody, clone 1351 |
CABT-L2597 |
Creative Diagnostics |
100 µg |
EUR 1029 |
|
Description: Mouse |
A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Tecentriq sequence |
TA813014 |
Origene Technologies GmbH |
100 µl |
Ask for price |
A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Tecentriq sequence |
TA813014S |
Origene Technologies GmbH |
30 µl |
Ask for price |
A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Avelumab sequence |
TA813015 |
Origene Technologies GmbH |
100 µl |
Ask for price |
A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Avelumab sequence |
TA813015S |
Origene Technologies GmbH |
30 µl |
Ask for price |
Humanized Monoclonal Anti-Human VEGF protein (Avastin/bevacizumab biosimilar) protein IgG1 (neutralizing) |
VEGF19-M |
Alpha Diagnostics |
50 ug |
EUR 578.4 |
TruStrip RDT 5-Minute rapid test to confirm the presence of humanized antibodies, 10 tests/pk |
1750-RDT-10 |
Alpha Diagnostics |
1 kit |
EUR 424.8 |
Carrier-free (BSA/glycerol-free) A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Tecentriq sequence |
CF813014 |
Origene Technologies GmbH |
100 µg |
Ask for price |
Carrier-free (BSA/glycerol-free) A humanized monoclonal antibody against PDL1 expressed in CHO cells according to Avelumab sequence |
CF813015 |
Origene Technologies GmbH |
100 µg |
Ask for price |
Humanized Monoclonal Anti-Flavivirus Envelope Protein DII (EDII) IgG1 (Crossreactive with Dengue, Zika, West Nile, JEV, etc) |
ZENV17-M |
Alpha Diagnostics |
100 ul |
EUR 578.4 |
Humanized Monoclonal Anti-Zika Virus Envelope Protein DIII (EDIII) IgM (non-reactive with related flavivruses; Neutralizing) |
ZENV16-M |
Alpha Diagnostics |
100 ul |
EUR 578.4 |
HA Tag Chimeric Human Antibody |
R20305-100UG |
NSJ Bioreagents |
100ug |
EUR 347.65 |
|
Description: This antibody reacts to recombinant proteins containing a HA-Tag fused to either the amino or carboxy terminus. An anti-human IgG secondary is required for this mAb. No cross reactivity with any endogenous protein. |
His Tag Chimeric Human Antibody |
R20303-100UG |
NSJ Bioreagents |
100ug |
EUR 347.65 |
|
Description: This antibody is a Human-Rabbit chimeric antibody made by fusion of the antigen binding region (variable domains of the heavy and light chains, VH and VL) of rabbit anti-His Tag monoclonal antibody (RM146), with the constant domain of Human IgG1. The mAb is recognized only by an anti-Human IgG secondary antibody. |
Welcome to our blog!