Welcome to our blog!

Apoptosis

A form of programmed cell death that occurs in multicellular organisms

Menu

Appreviation For Human Monoclonal Antibody

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the appreviation for human monoclonal antibody reagents distributed by Genprice. The Appreviation For Human Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Appreviation products are available in stock. Specificity: Appreviation Category: For Group: Human Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Human Monoclonal information

Monoclonal antibody for Kv3.2

SMC-492D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with RPE.

Monoclonal antibody for Kv3.2

SMC-492D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with Streptavidin.

Monoclonal antibody for Kv3.2

SMC-492S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is not conjugated.

Monoclonal antibody for p23

SMC-156D-A565 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 565.

Monoclonal antibody for p23

SMC-156D-A633 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 633.

Monoclonal antibody for p23

SMC-156D-A655 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 655.

Monoclonal antibody for p23

SMC-156D-A680 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 680.

Monoclonal antibody for p23

SMC-156D-A700 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 700.

Monoclonal antibody for p23

SMC-156D-APCCY7 0.1mg
EUR 502.8
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with APC/Cy7.

Monoclonal antibody for p23

SMC-156D-DY350 0.1mg
EUR 434.4
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 350.

Monoclonal antibody for p23

SMC-156D-DY405 0.1mg
EUR 421.2
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 405.

Monoclonal antibody for p23

SMC-156D-DY488 0.1mg
EUR 409.2
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 488.

Monoclonal antibody for p23

SMC-156D-DY594 0.1mg
EUR 411.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 594.

Monoclonal antibody for p23

SMC-156D-DY633 0.1mg
EUR 405.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 633.

Monoclonal antibody for p23

SMC-156D-P594 0.1mg
EUR 426
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with PE/ATTO 594.

Monoclonal antibody for p23

SMC-156D-STR 0.1mg
EUR 415.2
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Streptavidin.

Monoclonal antibody for FIH

SMC-182D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone FIH 162c against Human | Mouse | Rat FIH. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Full length human FIH expressed in E.coli BL21 (DE3) cells. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:100), IHC (1:100), ICC/IF (1:100). This MAb for FIH is not conjugated.

A nice attention grabbing header!

A descriptive sentence for the Call To Action (CTA).

Contact Us