Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Antibody Laboratories manufactures the appreviation for human monoclonal antibody reagents distributed by Genprice. The Appreviation For Human Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Appreviation products are available in stock. Specificity: Appreviation Category: For Group: Human Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Human Monoclonal information
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438265-01mgWithBSAAzideat02mgmL |
MyBiosource |
0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 405 |
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438265-01mgWithoutBSAat1mgmL |
MyBiosource |
0.1mg(WithoutBSAat1mg/mL) |
EUR 405 |
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438265-5x01mgWithBSAAzideat02mgmL |
MyBiosource |
5x0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 1725 |
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438265-5x01mgWithoutBSAat1mgmL |
MyBiosource |
5x0.1mg(WithoutBSAat1mg/mL) |
EUR 1725 |
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438290-002mgWithBSAAzideat02mgmL |
MyBiosource |
0.02mg(WithBSA&Azideat0.2mg/mL) |
EUR 230 |
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438290-01mgWithBSAAzideat02mgmL |
MyBiosource |
0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 405 |
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438290-01mgWithoutBSAat1mgmL |
MyBiosource |
0.1mg(WithoutBSAat1mg/mL) |
EUR 405 |
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438290-5x01mgWithBSAAzideat02mgmL |
MyBiosource |
5x0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 1725 |
Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS438290-5x01mgWithoutBSAat1mgmL |
MyBiosource |
5x0.1mg(WithoutBSAat1mg/mL) |
EUR 1725 |
Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody |
MBS438004-002mgWithBSAAzideat02mgmL |
MyBiosource |
0.02mg(WithBSA&Azideat0.2mg/mL) |
EUR 230 |
Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody |
MBS438004-01mgWithBSAAzideat02mgmL |
MyBiosource |
0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 405 |
Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody |
MBS438004-01mgWithoutBSAAzideat1mgmL |
MyBiosource |
0.1mg(WithoutBSA&Azideat1mg/mL) |
EUR 405 |
Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody |
MBS438004-5x01mgWithBSAAzideat02mgmL |
MyBiosource |
5x0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 1725 |
Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody |
MBS438004-5x01mgWithoutBSAAzideat1mgmL |
MyBiosource |
5x0.1mg(WithoutBSA&Azideat1mg/mL) |
EUR 1725 |
Golgi Complex (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS439732-002mgWithBSAAzideat02mgmL |
MyBiosource |
0.02mg(WithBSA&Azideat0.2mg/mL) |
EUR 230 |
Golgi Complex (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS439732-01mgWithBSAAzideat02mgmL |
MyBiosource |
0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 405 |
Golgi Complex (Marker for Human Cells) Mouse Monoclonal Antibody |
MBS439732-01mgWithoutBSAAzideat1mgmL |
MyBiosource |
0.1mg(WithoutBSA&Azideat1mg/mL) |
EUR 405 |
Welcome to our blog!