Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D | Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Antibody Laboratories manufactures the appreviation for human monoclonal antibody reagents distributed by Genprice. The Appreviation For Human Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Appreviation products are available in stock. Specificity: Appreviation Category: For Group: Human Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 472.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Monoclonal antibody for Tau |
|||
SMC-607D-RPE | Stressmarq | 0.1mg | EUR 541.2 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with RPE. |
Monoclonal antibody for Tau |
|||
SMC-607D-STR | Stressmarq | 0.1mg | EUR 542.4 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Streptavidin. |
Monoclonal antibody for Tau |
|||
SMC-607S | Stressmarq | 0.012mg | EUR 78 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is not conjugated. |
Monoclonal antibody for Tau |
|||
SMC-608D | Stressmarq | 0.1mg | EUR 489.6 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is not conjugated. |
Monoclonal antibody for Tau |
|||
SMC-608D-A390 | Stressmarq | 0.1mg | EUR 546 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 390. |
Monoclonal antibody for Tau |
|||
SMC-608D-A488 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 488. |
Monoclonal antibody for Tau |
|||
SMC-608D-A565 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 565. |
Monoclonal antibody for Tau |
|||
SMC-608D-A594 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 594. |
Monoclonal antibody for Tau |
|||
SMC-608D-A633 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 633. |
Monoclonal antibody for Tau |
|||
SMC-608D-A655 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 655. |
Monoclonal antibody for Tau |
|||
SMC-608D-A680 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 680. |
Monoclonal antibody for Tau |
|||
SMC-608D-A700 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 700. |
Monoclonal antibody for Tau |
|||
SMC-608D-ALP | Stressmarq | 0.1mg | EUR 537.6 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for Tau |
|||
SMC-608D-APC | Stressmarq | 0.1mg | EUR 543.6 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with APC. |
Monoclonal antibody for Tau |
|||
SMC-608D-APCCY7 | Stressmarq | 0.1mg | EUR 630 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with APC/Cy7. |
Monoclonal antibody for Tau |
|||
SMC-608D-BI | Stressmarq | 0.1mg | EUR 540 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Biotin. |
Monoclonal antibody for Tau |
|||
SMC-608D-DY350 | Stressmarq | 0.1mg | EUR 561.6 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Dylight 350. |
Welcome to our blog!