Welcome to our blog!

Apoptosis

A form of programmed cell death that occurs in multicellular organisms

Menu

Appreviation For Human Monoclonal Antibody

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the appreviation for human monoclonal antibody reagents distributed by Genprice. The Appreviation For Human Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Appreviation products are available in stock. Specificity: Appreviation Category: For Group: Human Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Human Monoclonal information

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438265-01mgWithBSAAzideat02mgmL 0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 405

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438265-01mgWithoutBSAat1mgmL 0.1mg(WithoutBSAat1mg/mL)
EUR 405

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438265-5x01mgWithBSAAzideat02mgmL 5x0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 1725

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438265-5x01mgWithoutBSAat1mgmL 5x0.1mg(WithoutBSAat1mg/mL)
EUR 1725

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438290-002mgWithBSAAzideat02mgmL 0.02mg(WithBSA&Azideat0.2mg/mL)
EUR 230

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438290-01mgWithBSAAzideat02mgmL 0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 405

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438290-01mgWithoutBSAat1mgmL 0.1mg(WithoutBSAat1mg/mL)
EUR 405

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438290-5x01mgWithBSAAzideat02mgmL 5x0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 1725

Mitochondria (Marker for Human Cells) Mouse Monoclonal Antibody

MBS438290-5x01mgWithoutBSAat1mgmL 5x0.1mg(WithoutBSAat1mg/mL)
EUR 1725

Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody

MBS438004-002mgWithBSAAzideat02mgmL 0.02mg(WithBSA&Azideat0.2mg/mL)
EUR 230

Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody

MBS438004-01mgWithBSAAzideat02mgmL 0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 405

Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody

MBS438004-01mgWithoutBSAAzideat1mgmL 0.1mg(WithoutBSA&Azideat1mg/mL)
EUR 405

Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody

MBS438004-5x01mgWithBSAAzideat02mgmL 5x0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 1725

Human Nucleolar Antigen (Marker For Human Cells) Mouse Monoclonal Antibody

MBS438004-5x01mgWithoutBSAAzideat1mgmL 5x0.1mg(WithoutBSA&Azideat1mg/mL)
EUR 1725

Golgi Complex (Marker for Human Cells) Mouse Monoclonal Antibody

MBS439732-002mgWithBSAAzideat02mgmL 0.02mg(WithBSA&Azideat0.2mg/mL)
EUR 230

Golgi Complex (Marker for Human Cells) Mouse Monoclonal Antibody

MBS439732-01mgWithBSAAzideat02mgmL 0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 405

Golgi Complex (Marker for Human Cells) Mouse Monoclonal Antibody

MBS439732-01mgWithoutBSAAzideat1mgmL 0.1mg(WithoutBSA&Azideat1mg/mL)
EUR 405

A nice attention grabbing header!

A descriptive sentence for the Call To Action (CTA).

Contact Us